PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g19300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family B3
Protein Properties Length: 908aa    MW: 101063 Da    PI: 8.3381
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g19300.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.22e-1521971799
                    E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                     +p  f+ +++g + +s   +l+ +sg++W+v l   k+++  ++  GW++Fv +++L+ gD +vF+++g+  f  +v+vf+k
  Vang01g19300.1 21 KIPDGFVCRMEGRTYGS--FSLTGPSGNVWTVHL--LKQDNDLFFHHGWSSFVVDHRLECGDLLVFRYEGHLHF--TVQVFDK 97
                    57777777777777665..8899***********..********************************987666..9999997 PP

2B346.56.6e-15246337296
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     + ++++ +v+ s  l +p +f  +h   ++++++++l +++g+ W+v+    ++   +++l +GW  Fv+ n++k gD+++F+l+++ e   +v+
  Vang01g19300.1 246 VRIMKSFNVSGSYTLNIPYQFSMAHL--PNCKIKIILHNLKGEHWTVNSVPtTRVHTSHTLCGGWMAFVRGNNIKIGDICIFELVNECEL--RVH 336
                     56667777888899*******98996..46999***************954566666799***********************9986555..554 PP

                     E CS
              B3  96 v 96 
                     +
  Vang01g19300.1 337 I 337
                     4 PP

3B335.61.7e-114455042886
                     --..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3  28 gkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldg 86 
                     + ++ +++++l++++g+ W+v+   + k+++ +++ +GW  Fv++n+++ gD+++F+l+ 
  Vang01g19300.1 445 HLPTYKTEVILRNSRGECWTVNSVPDAKGRTvHTFCGGWMAFVRDNDINFGDTCIFELVT 504
                     33455679***************77666666799***********************875 PP

4B356.55.1e-185105851798
                     E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      lpk+f ++ ++k++    +tl+ +sg  W+v +    ++++ +++ GW++Fvk++ Lke+Df+vFk++g+s+f   v vf+
  Vang01g19300.1 510 ALPKTFSDNLKKKPPA--NVTLKGPSGVAWNVGI--ITSGDTLYFACGWEQFVKDHCLKENDFLVFKYNGESQF--DVLVFD 585
                     79****9666766554..7***************..999999****************************9999..777776 PP

5B342.71e-13782870394
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      v+ ps+v k+  +++p+k + eh   ++ s++++l+  +  +W  +++y + + +  lt+GWk+Fv +n+L+e D++vFk  g+++ +lv+
  Vang01g19300.1 782 VVMRPSHVYKRFFVSMPNKWIGEHI--PPMSQDVILRM-DKGEWVARYSYHNIRHTGGLTGGWKHFVLDNNLEEYDVCVFKPAGQMNDNLVL 870
                     5789*****************9995..44666898887.5669*******88888888***********************88887666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010193.2E-7698IPR003340B3 DNA binding domain
CDDcd100173.85E-151496No hitNo description
SuperFamilySSF1019365.89E-1921103IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-1721100IPR015300DNA-binding pseudobarrel domain
PfamPF023621.0E-122197IPR003340B3 DNA binding domain
PROSITE profilePS5086312.5762298IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.9E-21236338IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.9E-23238339IPR015300DNA-binding pseudobarrel domain
CDDcd100179.25E-19243337No hitNo description
SMARTSM010191.3E-10245343IPR003340B3 DNA binding domain
PfamPF023621.2E-11245337IPR003340B3 DNA binding domain
PROSITE profilePS5086312.788245341IPR003340B3 DNA binding domain
SuperFamilySSF1019363.14E-12443508IPR015300DNA-binding pseudobarrel domain
CDDcd100175.43E-9444503No hitNo description
Gene3DG3DSA:2.40.330.107.6E-12444508IPR015300DNA-binding pseudobarrel domain
PfamPF023622.8E-8445504IPR003340B3 DNA binding domain
PROSITE profilePS5086314.452494587IPR003340B3 DNA binding domain
SMARTSM010191.4E-10500587IPR003340B3 DNA binding domain
CDDcd100178.33E-18503585No hitNo description
SuperFamilySSF1019366.67E-19508585IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.1E-19509585IPR015300DNA-binding pseudobarrel domain
PfamPF023621.3E-14509583IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.3E-18778876IPR015300DNA-binding pseudobarrel domain
CDDcd100171.46E-17779876No hitNo description
SMARTSM010191.1E-11780878IPR003340B3 DNA binding domain
SuperFamilySSF1019361.96E-16780864IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.405780878IPR003340B3 DNA binding domain
PfamPF023626.7E-12781870IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005773Cellular Componentvacuole
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 908 aa     Download sequence    Send to blast
LVLGSTETAS FPWTKFARAH KIPDGFVCRM EGRTYGSFSL TGPSGNVWTV HLLKQDNDLF  60
FHHGWSSFVV DHRLECGDLL VFRYEGHLHF TVQVFDKDGC EKEAAFMSEC SQSSSDFEEI  120
VGQKRDVKES SSLDIAFDGV AKKRRGCKYE NREHEPGFVG KELLRYEVVR PIRMFRETEE  180
TSKACLANDS LVPFHMDHRN EEAAILYRNG KEDGHYFLGG VSLSNVSAQD EKKVAQSFTS  240
KFPYFVRIMK SFNVSGSYTL NIPYQFSMAH LPNCKIKIIL HNLKGEHWTV NSVPTTRVHT  300
SHTLCGGWMA FVRGNNIKIG DICIFELVNE CELRVHIAGV GKDGLEDDQV GRVNAGHAGT  360
TRYMPMNAKV NSKSIRKVDL SDKKWPKIGQ ETVLSIDLKK SGRASNTSKK MGLCPQSKAA  420
HKKLATPRRH RVEDELSSQA KSAAHLPTYK TEVILRNSRG ECWTVNSVPD AKGRTVHTFC  480
GGWMAFVRDN DINFGDTCIF ELVTQCEMQA LPKTFSDNLK KKPPANVTLK GPSGVAWNVG  540
IITSGDTLYF ACGWEQFVKD HCLKENDFLV FKYNGESQFD VLVFDGGSLC EKASSYFVRK  600
CGHTEAEDVG GSLNKKRDNA EDPMKEGHIP LKAGVQCASP GKSVHANGTK EPINVPFETP  660
TPSEEAFNAD VESAGAEQIT SDGVPLSAVP KETVNGKRIR KLASVVKHVQ TKRRGRGRPA  720
KVSTVIERAL DWVSGLDAEP VSAVRSAAQE AFISNRRPVT DDEIKNALAL AQAGRTDDSL  780
VVVMRPSHVY KRFFVSMPNK WIGEHIPPMS QDVILRMDKG EWVARYSYHN IRHTGGLTGG  840
WKHFVLDNNL EEYDVCVFKP AGQMNDNLVL DMSIFRVVEE IVPLSVMSPT GKRGRKPAAQ  900
NAILTET*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00468DAPTransfer from AT4G33280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502687.10.0PREDICTED: B3 domain-containing protein Os11g0197600
TrEMBLA0A0S3RQ200.0A0A0S3RQ20_PHAAN; Uncharacterized protein
STRINGGLYMA14G08641.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114703238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.16e-32B3 family protein